Talpa occidentalis (Iberian mole): 119244792 Help Entry 119244792         CDS       T07495                                  Name (RefSeq) signal transducer CD24-like   KO K06469   CD24 antigen Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04148   Efferocytosis tod04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:tod00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     119244792  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     119244792  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:tod04090]     119244792    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tod00537]     119244792 CD molecules [BR:tod04090]  Proteins   119244792 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tod00537]  Antigens   119244792 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD24 New_glue Motif Other DBs NCBI-GeneID:  119244792 NCBI-ProteinID:  XP_037366715 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MGRAMVARLGLGLLLLALLLPTQIYSQSTTSTSSVVAPTSNATQSTLTAPNPTNGTTASD GALKSTASLFVILFSLLHLYC NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgggtagagccatggtagccaggctggggctggggctgctgcttctggcactgctcctc cccacgcagatttattcacagtctacaacttcaacttcttctgtagtagctcctacaagt aatgctacccagtctaccttgacagccccaaatccaactaatggcaccacggcaagtgac ggtgccctgaagtccacagccagtctcttcgtgatcttgttctccctcctgcatctctac tgttaa

DBGET integrated database retrieval system