Talpa occidentalis (Iberian mole): 119246593 Help Entry 119246593         CDS       T07495                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04613   Neutrophil extracellular trap formation tod05034   Alcoholism tod05203   Viral carcinogenesis tod05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119246593  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     119246593   09163 Immune disease    05322 Systemic lupus erythematosus     119246593   09165 Substance dependence    05034 Alcoholism     119246593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119246593   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119246593 Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119246593 Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119246593 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone TAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  119246593 NCBI-ProteinID:  XP_037368848 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MADPAVEASTEETLGSGEPAKAKPQSLKRKQKQKHKQPPKQKQPARQRRAKNQSESFAPY FPQVLKCVHMGLSLSQEAVSVLDSFVKDMFERIAQEAGHLARSTQRATLTSREIQTAVRL LLPGDLGKHAVSEGTKAVIRYSHSE NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggccgatcctgccgtcgaggcttcgactgaggagaccctgggctcaggggagccggca aaagccaagccgcagagcctgaagcggaagcagaagcagaagcacaagcagccccccaag cagaagcagccagcgcgccagcggcgggccaagaaccaaagtgagagcttcgccccctac ttccctcaggttctcaagtgcgtccacatgggcctgagcctttcgcaggaggccgtgagc gtcctggattccttcgtgaaggacatgtttgagcgcatcgcccaggaggccggccacctg gcccgctccacccagcgcgccaccctcacgtccagagagatccagacggccgtgcgcctg ctgctgcccggcgacctcggcaagcacgccgtgagtgagggcaccaaggccgtcatcaga tacagccactcggaatga

DBGET integrated database retrieval system