Talpa occidentalis (Iberian mole): 119249534 Help Entry 119249534         CDS       T07495                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04010   MAPK signaling pathway tod04014   Ras signaling pathway tod04015   Rap1 signaling pathway tod04020   Calcium signaling pathway tod04151   PI3K-Akt signaling pathway tod04714   Thermogenesis tod04810   Regulation of actin cytoskeleton tod05200   Pathways in cancer tod05218   Melanoma tod05224   Breast cancer tod05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119249534 (FGF21)    04014 Ras signaling pathway     119249534 (FGF21)    04015 Rap1 signaling pathway     119249534 (FGF21)    04020 Calcium signaling pathway     119249534 (FGF21)    04151 PI3K-Akt signaling pathway     119249534 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119249534 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     119249534 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119249534 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     119249534 (FGF21)    05218 Melanoma     119249534 (FGF21)    05224 Breast cancer     119249534 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119249534 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119249534 (FGF21) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Growth factors (RTK binding)    119249534 (FGF21) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Growth factors/receptors    119249534 (FGF21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  119249534 NCBI-ProteinID:  XP_037372829 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MGWAEARSEHQGLWVPVLVALLLGASQAHPIPDSSPLLQFGGQVRHRYLYTDDAQKVEAH LEIRADGTVVGAARRSAESLLELKALKPGVIQIFGVRTSRFLCQGPDGTLYGSLRFDPEA CSFRELLLEDGYNIYQSEALGIPLRLPPHSSASREPASRGPARFLPLPGLPQAPTDPSGI LAPEPPDVGSSDPLSMVGPSQGRSPSYTS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggccgaggccaggtctgagcaccagggactgtgggtccctgtgctggtcgcc cttctgctgggagcctcccaggcacaccccatccctgactccagtcccctcctccaattc ggaggccaagtccggcatcggtacctctacacagatgacgcccagaaggtagaggcccac ttggagatcagggccgacggtacagtggtgggagctgcccgcaggagtgccgaaagtctc ctggagctgaaagccctgaagccaggggtcattcagatattcggtgtgaggacatccagg ttcctgtgccaggggcctgacgggacactgtacggctcgctccgttttgatcctgaagcc tgcagtttcagggagctgcttctcgaggatggatacaacatttaccagtcagaggccctg ggcatcccgctccgcctgccgccacacagctctgcatcccgggaaccagcctctcgggga cctgccagattcctgccactgccaggcctgccccaggcccctacagacccttcgggcatc ctggcccccgagcctcccgacgtgggctcctcagaccctctgagtatggtggggccttcg cagggccgaagtcctagctacacttcttga

DBGET integrated database retrieval system