Talpa occidentalis (Iberian mole): 119249549 Help Entry 119249549         CDS       T07495                                  Name (RefSeq) apoptosis regulator BAX-like   KO K02159   apoptosis regulator BAX Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01521   EGFR tyrosine kinase inhibitor resistance tod01522   Endocrine resistance tod01524   Platinum drug resistance tod04071   Sphingolipid signaling pathway tod04115   p53 signaling pathway tod04141   Protein processing in endoplasmic reticulum tod04210   Apoptosis tod04211   Longevity regulating pathway tod04215   Apoptosis - multiple species tod04217   Necroptosis tod04722   Neurotrophin signaling pathway tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05016   Huntington disease tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05165   Human papillomavirus infection tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05200   Pathways in cancer tod05202   Transcriptional misregulation in cancer tod05203   Viral carcinogenesis tod05210   Colorectal cancer tod05212   Pancreatic cancer tod05213   Endometrial cancer tod05214   Glioma tod05216   Thyroid cancer tod05217   Basal cell carcinoma tod05218   Melanoma tod05220   Chronic myeloid leukemia tod05222   Small cell lung cancer tod05223   Non-small cell lung cancer tod05224   Breast cancer tod05225   Hepatocellular carcinoma tod05226   Gastric cancer tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119249549  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     119249549  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     119249549    04215 Apoptosis - multiple species     119249549    04217 Necroptosis     119249549    04115 p53 signaling pathway     119249549  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     119249549   09149 Aging    04211 Longevity regulating pathway     119249549  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119249549    05202 Transcriptional misregulation in cancer     119249549    05203 Viral carcinogenesis     119249549   09162 Cancer: specific types    05210 Colorectal cancer     119249549    05212 Pancreatic cancer     119249549    05225 Hepatocellular carcinoma     119249549    05226 Gastric cancer     119249549    05214 Glioma     119249549    05216 Thyroid cancer     119249549    05220 Chronic myeloid leukemia     119249549    05217 Basal cell carcinoma     119249549    05218 Melanoma     119249549    05213 Endometrial cancer     119249549    05224 Breast cancer     119249549    05222 Small cell lung cancer     119249549    05223 Non-small cell lung cancer     119249549   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119249549    05170 Human immunodeficiency virus 1 infection     119249549    05161 Hepatitis B     119249549    05160 Hepatitis C     119249549    05164 Influenza A     119249549    05162 Measles     119249549    05168 Herpes simplex virus 1 infection     119249549    05163 Human cytomegalovirus infection     119249549    05167 Kaposi sarcoma-associated herpesvirus infection     119249549    05169 Epstein-Barr virus infection     119249549    05165 Human papillomavirus infection     119249549   09171 Infectious disease: bacterial    05132 Salmonella infection     119249549    05152 Tuberculosis     119249549   09164 Neurodegenerative disease    05012 Parkinson disease     119249549    05014 Amyotrophic lateral sclerosis     119249549    05016 Huntington disease     119249549    05020 Prion disease     119249549    05022 Pathways of neurodegeneration - multiple diseases     119249549   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119249549   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     119249549    04933 AGE-RAGE signaling pathway in diabetic complications     119249549   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     119249549    01524 Platinum drug resistance     119249549    01522 Endocrine resistance     119249549  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:tod03029]     119249549   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tod02000]     119249549 Mitochondrial biogenesis [BR:tod03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     119249549 Transporters [BR:tod02000]  Other transporters   Pores ion channels [TC:1]    119249549 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 YtxC Motif Other DBs NCBI-GeneID:  119249549 NCBI-ProteinID:  XP_054553491 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search GAAAKDVAQLALEQVTQGPYIKELLEVVKRIAQQVDNDKELQRFLETLRGFSSGEFSQVA RQIFLDGITWGKIVTLFCFASKLVLKALCTDMRELITSIVGWTLDFIRKPLLPWIQDHGG WGGLLSQHSNKIKWLAVAVAVAIIGTECLPYSESGPSQAEAPAALISVFSASM NT seq 522 nt NT seq  +upstreamnt  +downstreamnt ggagcagccgcaaaggatgtagctcagctggccctagagcaggtgacccagggcccatac atcaaagaactgctggaagttgtcaagcgcatcgcacaacaggtggacaatgacaaggag ctgcagaggtttttagaaactctcagaggcttcagttctggcgaattttctcaagtggca cgccaaatatttttagacggcatcacctggggcaaaattgtcacccttttctgctttgcc agcaaactggtactcaaggccctgtgcacggacatgcgggagctgatcaccagcatcgtt ggctggacgctggacttcattcgaaagccactgctgccctggatccaggatcatggtggc tggggcggcctcctctcacaacacagtaataaaatcaagtggctcgcagtggcagtggct gtggccatcatcgggactgagtgtttgccttattcagagtccggaccatctcaggctgag gccccagctgccttgatctctgtcttttcagcatcaatgtga

DBGET integrated database retrieval system