Talpa occidentalis (Iberian mole): 119250400 Help Entry 119250400         CDS       T07495                                  Name (RefSeq) metallothionein-2A-like   KO K14739   metallothionein 1/2 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04978   Mineral absorption Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     119250400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tod03019]     119250400    03029 Mitochondrial biogenesis [BR:tod03029]     119250400 Messenger RNA biogenesis [BR:tod03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      119250400 Mitochondrial biogenesis [BR:tod03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     119250400 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  119250400 NCBI-ProteinID:  XP_037374025 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCGAGGSCTCAGSCTCKGCKCTSRKKSCCSCCPQGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcggcgctggtggctcctgcacctgtgctggctcctgcacc tgcaaaggctgcaaatgcacctcccgcaagaagagctgctgctcctgctgcccccagggc tgtgccaagtgtgcccagggctgtgtgtgcaaaggagcatctgacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system