Talpa occidentalis (Iberian mole): 119250505 Help Entry 119250505         CDS       T07495                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04010   MAPK signaling pathway tod04014   Ras signaling pathway tod04015   Rap1 signaling pathway tod04020   Calcium signaling pathway tod04151   PI3K-Akt signaling pathway tod04810   Regulation of actin cytoskeleton tod05200   Pathways in cancer tod05207   Chemical carcinogenesis - receptor activation tod05218   Melanoma tod05224   Breast cancer tod05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119250505 (FGF4)    04014 Ras signaling pathway     119250505 (FGF4)    04015 Rap1 signaling pathway     119250505 (FGF4)    04020 Calcium signaling pathway     119250505 (FGF4)    04151 PI3K-Akt signaling pathway     119250505 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119250505 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119250505 (FGF4)    05207 Chemical carcinogenesis - receptor activation     119250505 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     119250505 (FGF4)    05218 Melanoma     119250505 (FGF4)    05224 Breast cancer     119250505 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119250505 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119250505 (FGF4) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Growth factors (RTK binding)    119250505 (FGF4) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Growth factors/receptors    119250505 (FGF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  119250505 NCBI-ProteinID:  XP_037374143 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAALAPWAGRGGAAAPALPNGTLEAELERRWESLVARSLARLPA AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFQLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIYGVASRFFVAMSSKGKLYGSPFFTDECKFKEILLPNNYNAYECHQHPGLFIA LSKNGKTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgccgcggcgctgctccccgcggtcctgctggccgcgctg gcgccctgggcgggccgcgggggtgccgccgcgcccgccctgcccaacggcacgctggag gccgagctggagcgccgctgggagagcctggtggcgcgctcgctggcgcgcctgcccgcg gccgcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc aagcggctgcgccggctctactgcaacgtgggcatcggcttccagctccaggtgctcccc gacggccgcatcggcggcgtgcacgccgacacgagcgacagcctgctggagctctcgccg gtggagaggggcgtcgtcagcatctacggcgtggccagccgcttcttcgtggccatgagc agcaagggcaaactgtacggctcgcctttcttcaccgacgagtgcaagttcaaagagatc ctcctgcccaacaactacaacgcctacgagtgccaccagcaccccggcctgttcatcgcc ctgagcaagaacggcaagaccaagaaggggaaccgggtgtcccccaccatgaaggtcacc cacttccttccccgactgtga

DBGET integrated database retrieval system