Talpa occidentalis (Iberian mole): 119251783 Help Entry 119251783         CDS       T07495                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04613   Neutrophil extracellular trap formation tod05034   Alcoholism tod05203   Viral carcinogenesis tod05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119251783  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     119251783   09163 Immune disease    05322 Systemic lupus erythematosus     119251783   09165 Substance dependence    05034 Alcoholism     119251783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119251783 Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119251783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  119251783 NCBI-ProteinID:  XP_037374946 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaaaggtgggaaggggctcggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgg cgcggcggcgtcaagcgcatctcggggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgatccgcgacgccgtcacctacaccgagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc tttggcggctaa

DBGET integrated database retrieval system