Talpa occidentalis (Iberian mole): 119256206 Help Entry 119256206         CDS       T07495                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04137   Mitophagy - animal tod04140   Autophagy - animal tod04144   Endocytosis tod04145   Phagosome tod04148   Efferocytosis tod05132   Salmonella infection tod05146   Amoebiasis tod05152   Tuberculosis Brite KEGG Orthology (KO) [BR:tod00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119256206 (RAB7A)    04145 Phagosome     119256206 (RAB7A)    04140 Autophagy - animal     119256206 (RAB7A)    04137 Mitophagy - animal     119256206 (RAB7A)    04148 Efferocytosis     119256206 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119256206 (RAB7A)    05152 Tuberculosis     119256206 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     119256206 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119256206 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119256206 (RAB7A)    04031 GTP-binding proteins [BR:tod04031]     119256206 (RAB7A) Membrane trafficking [BR:tod04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     119256206 (RAB7A) Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119256206 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    119256206 (RAB7A)   Exosomal proteins of colorectal cancer cells    119256206 (RAB7A)   Exosomal proteins of bladder cancer cells    119256206 (RAB7A) GTP-binding proteins [BR:tod04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     119256206 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  119256206 NCBI-ProteinID:  XP_037379932 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASTESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttactatgcag atctgggacacagcaggacaggaacggttccagtctcttggcgtggccttctacagaggt gcagactgctgcgtcctggtgtttgacgtgactgcccccaataccttcaaaacccttgat agttggagggatgagtttctcattcaggccagtccccgtgatccggaaaacttccccttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaagcgtttcagacgattgcacggaatgcacttaaacaggaaacggaggtg gagctgtacaatgaattccctgaacccatcaaactggataagaatgaccgggccaaggcc tccacggagagctgcagttgctga

DBGET integrated database retrieval system