Talpa occidentalis (Iberian mole): 119257198 Help Entry 119257198         CDS       T07495                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04014   Ras signaling pathway tod04137   Mitophagy - animal tod04144   Endocytosis tod04145   Phagosome tod04148   Efferocytosis tod04962   Vasopressin-regulated water reabsorption tod05014   Amyotrophic lateral sclerosis tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05146   Amoebiasis tod05152   Tuberculosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119257198 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119257198 (RAB5A)    04145 Phagosome     119257198 (RAB5A)    04137 Mitophagy - animal     119257198 (RAB5A)    04148 Efferocytosis     119257198 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     119257198 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119257198 (RAB5A)    05152 Tuberculosis     119257198 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     119257198 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119257198 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     119257198 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119257198 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119257198 (RAB5A)    04031 GTP-binding proteins [BR:tod04031]     119257198 (RAB5A) Membrane trafficking [BR:tod04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     119257198 (RAB5A)  Endosome - Lysosome transport     119257198 (RAB5A) Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119257198 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    119257198 (RAB5A)   Exosomal proteins of colorectal cancer cells    119257198 (RAB5A)   Exosomal proteins of bladder cancer cells    119257198 (RAB5A) GTP-binding proteins [BR:tod04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     119257198 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  119257198 NCBI-ProteinID:  XP_037380849 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagaaagtaccatcggggctgcttttcttacccaa accgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagag cgatatcatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgttgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaaggggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system