Talpa occidentalis (Iberian mole): 119257681 Help Entry 119257681         CDS       T07495                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04015   Rap1 signaling pathway tod04810   Regulation of actin cytoskeleton tod05014   Amyotrophic lateral sclerosis tod05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     119257681 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119257681 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119257681 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119257681 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119257681 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tod04812]     119257681 (PFN2)    04147 Exosome [BR:tod04147]     119257681 (PFN2) Membrane trafficking [BR:tod04131]  Others   Actin-binding proteins    Others     119257681 (PFN2) Cytoskeleton proteins [BR:tod04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      119257681 (PFN2) Exosome [BR:tod04147]  Exosomal proteins   Proteins found in most exosomes    119257681 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  119257681 NCBI-ProteinID:  XP_037381708 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcataacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgacccttggcgcaaagaagtgctcagtgatcagagatagtctatatgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system