Talpa occidentalis (Iberian mole): 119259911 Help Entry 119259911         CDS       T07495                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism tod  Talpa occidentalis (Iberian mole) Brite KEGG Orthology (KO) [BR:tod00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:tod03029]     119259911 (MTLN) Mitochondrial biogenesis [BR:tod03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     119259911 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  119259911 NCBI-ProteinID:  XP_037384797 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MADVSERTLQVSVLVAFASGVLVGWQANRLRRRFLDWRKRRLQDKLAVMQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtgtccgagaggacgctgcaggtgtcagtgctggtggctttcgcctcggga gtgctggtgggctggcaggcaaatcggctgcggaggcgcttcctggactggaggaagcgg aggctgcaagacaagctggcggtgatgcagaagaagctggatctggcctga

DBGET integrated database retrieval system