Talpa occidentalis (Iberian mole): 119261085 Help Entry 119261085         CDS       T07495                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway tod04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119261085 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     119261085 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     119261085 (CCL28)    04062 Chemokine signaling pathway     119261085 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119261085 (CCL28) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119261085 (CCL28) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119261085 NCBI-ProteinID:  XP_037386208 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MQQMGLVLLALAACMALHTSEAILPIASSCCTEVSHHISRRLLDRVNICRIQRADGDCNL AAVILHIKQRRFCVSPHSHIIKQWMREQVKKNVHGNICHKKKHHNKRNNRGARRRFHEAH GHKMLF NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcagcagatgggacttgtgctcttggccttggctgcctgcatggcccttcacacctct gaagctatacttcccattgcatccagctgttgcacggaggtttcacatcatatttccaga aggcttctggatagagtgaatatatgtcgcattcagagagctgatggggattgtaacttg gctgcagtcatccttcatatcaagcaaagaagattctgtgtcagccctcacagtcatatt attaagcagtggatgagagaacaagtcaagaaaaatgttcacggcaacatttgccataag aagaaacaccacaacaagaggaacaatagaggggcccgtcggaggttccatgaagcccat ggccataagatgcttttctag

DBGET integrated database retrieval system