Talpa occidentalis (Iberian mole): 119261091 Help Entry 119261091         CDS       T07495                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway tod04064   NF-kappa B signaling pathway tod04072   Phospholipase D signaling pathway tod04218   Cellular senescence tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04622   RIG-I-like receptor signaling pathway tod04657   IL-17 signaling pathway tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod04936   Alcoholic liver disease tod05132   Salmonella infection tod05133   Pertussis tod05134   Legionellosis tod05135   Yersinia infection tod05142   Chagas disease tod05144   Malaria tod05146   Amoebiasis tod05161   Hepatitis B tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05167   Kaposi sarcoma-associated herpesvirus infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05202   Transcriptional misregulation in cancer tod05219   Bladder cancer tod05323   Rheumatoid arthritis tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     119261091 (CXCL8)    04072 Phospholipase D signaling pathway     119261091 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119261091 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     119261091 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     119261091 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119261091 (CXCL8)    04621 NOD-like receptor signaling pathway     119261091 (CXCL8)    04622 RIG-I-like receptor signaling pathway     119261091 (CXCL8)    04657 IL-17 signaling pathway     119261091 (CXCL8)    04062 Chemokine signaling pathway     119261091 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119261091 (CXCL8)    05202 Transcriptional misregulation in cancer     119261091 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     119261091 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     119261091 (CXCL8)    05171 Coronavirus disease - COVID-19     119261091 (CXCL8)    05164 Influenza A     119261091 (CXCL8)    05163 Human cytomegalovirus infection     119261091 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     119261091 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     119261091 (CXCL8)    05135 Yersinia infection     119261091 (CXCL8)    05133 Pertussis     119261091 (CXCL8)    05134 Legionellosis     119261091 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     119261091 (CXCL8)    05144 Malaria     119261091 (CXCL8)    05142 Chagas disease     119261091 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     119261091 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119261091 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     119261091 (CXCL8)    04932 Non-alcoholic fatty liver disease     119261091 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     119261091 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119261091 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119261091 (CXCL8) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119261091 (CXCL8) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Chemokines    119261091 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119261091 NCBI-ProteinID:  XP_037386213 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTAKLTVAFLAAVMLAAALCEAAIQPRTSTELRCQCINMHSKFFPPKYIKELRVIESGPH CEHSEVIVKLTNGKAVCLDPKEKWVQFVVQQFLKRAEKQSS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgactgccaagctgactgtggctttcctggcagctgtcatgctcgctgcagctctgtgt gaagctgcaattcagccaagaactagtacagaacttcgatgccagtgcataaatatgcac tccaaatttttccctcccaagtatattaaagaactgagagtgattgagagtggaccacac tgtgaacattcagaagtcattgtcaagctcactaatggaaaagctgtttgtctggacccc aaggaaaagtgggtgcagttcgttgtacagcaatttttgaagagagctgagaaacaaagt tcatga

DBGET integrated database retrieval system