Trabulsiella odontotermitis: QMG90_09685 Help Entry QMG90_09685       CDS       T09053                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism toe  Trabulsiella odontotermitis Pathway toe01100   Metabolic pathways toe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:toe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QMG90_09685 (acpP)    00074 Mycolic acid biosynthesis     QMG90_09685 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QMG90_09685 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  WHP33146 LinkDB All DBs Position 2027093..2027329 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system