Thermoleptolyngbya oregonensis: HNI00_10050 Help Entry HNI00_10050       CDS       T09452                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tog  Thermoleptolyngbya oregonensis Pathway tog01100   Metabolic pathways tog01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tog00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNI00_10050 (acpP)    00074 Mycolic acid biosynthesis     HNI00_10050 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNI00_10050 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 Motif Other DBs NCBI-ProteinID:  WOB43462 UniProt:  A0AA96YNH8 LinkDB All DBs Position complement(2314868..2315110) Genome browser AA seq 80 aa AA seqDB search MSDEILTKVKKIVSEQLSVEESEVNPESNFANDLGADSLDTVELVMALEEEFDIEIPDEA AEGIATVQAAVDYIKQKVAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgagattctcacaaaggtcaaaaagatcgtatccgagcaactgagcgtcgaa gagagtgaagtcaaccctgagtctaactttgccaacgacctgggcgcagactctctagac acggttgaactggtgatggcgctagaggaagaattcgatatcgaaattcccgacgaagcc gccgaaggcatcgctacggttcaagctgctgtggactacatcaagcaaaaggtcgctgcg tag

DBGET integrated database retrieval system