Thermoleptolyngbya oregonensis: HNI00_19480
Help
Entry
HNI00_19480 CDS
T09452
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
tog
Thermoleptolyngbya oregonensis
Brite
KEGG Orthology (KO) [BR:
tog00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
tog02000
]
HNI00_19480
Transporters [BR:
tog02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
HNI00_19480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
DUF5638
Motif
Other DBs
NCBI-ProteinID:
WOB45908
UniProt:
A0AA96YDW6
LinkDB
All DBs
Position
complement(4657597..4659261)
Genome browser
AA seq
554 aa
AA seq
DB search
MKPPDLNFRNFRDDFWGGLTAAIVALPLALAFGVSSGAGAATGLYGAIFVGIFAALFGGT
PAQVSGPTGPMTVVVATIFTVLIGRYPETGLALSFTVIALGGLFQILFGVLRLGTYITLM
PYTVISGFMSGIGVIIISLQIGPLFGYKGSSGVVDSLRNLPTYLTHPNGFALGLGLMTLA
IVFIWPRRLNRVIPSPLLALVIGTLVSLAFGEGANLTRIGAIPTTLPQPHWPAFEWEALR
VMTGYGLMLATLGSIDSLLTSLVADNITRTQHDSNQELIGQGIGNLLSGIFWGLPGAGAT
MRTVVNVQAGGKTRLSGMIHGVLLLLVMLGLGRLTEPIPNAVLAGILIKVGIDIIDWSFL
RRAHRLSLKATGLMYGVLFLTVFVDLITAVAVGVFFANLLTVKSLSDLQSKRVRAIIHPT
DEALAPEEQTLLEAGQGRIMLFQLSGPMSFGAAKAISQQMTLVQEYDVLILDLTEVPRLG
VTAALAIEAMVQEACRQRREVLLVGVEGSVRDRLQRLNLLNAMDENHVFPTRLSALQRAI
ALVIPPKQELEVRS
NT seq
1665 nt
NT seq
+upstream
nt +downstream
nt
ctgaaacccccagatctcaattttcgtaattttcgagatgacttttggggcggactcacc
gcagcaatcgtggcgttgccgctggcgctggcgtttggcgtatcgtccggagcaggagcg
gctacgggactctacggtgcaatcttcgtcggcattttcgcggcgttgtttggcggcacg
cccgctcaggtgtctggcccaaccgggccaatgacagtggtggtggcaacgattttcacg
gtactgattggccggtatcccgaaaccggactggcgctttcgtttaccgtcattgcgctg
ggcgggctgttccagattctgtttggggtgctgcgtttgggaacgtacatcacgcttatg
ccctacacggtcatttctggcttcatgtcgggcatcggggtcattattatctccctccag
attgggccgttgtttggctacaaagggtcgagtggagtcgtggattctctgcggaacctg
ccgacgtatctgacgcaccccaacgggttcgcgctggggctggggctgatgacgttggcg
atcgtgtttatctggccgcgtcggctgaatcgtgtcattccatccccccttctggcgctg
gtgatcgggacactcgtatcgctggcttttggcgagggtgcaaacctgacgcggattggg
gccattcccacgacactgccgcagccgcactggccggcgtttgagtgggaggcgctgcgc
gtgatgacgggctacgggctgatgctggcgacgctgggatcgatcgactcgctgctgact
tctctcgttgccgacaacatcacccggacacagcacgattccaaccaggaattgatcggc
cagggcatcggcaatttgctgtcgggcattttttggggattgccgggggccggggcaacc
atgcggacggttgtgaatgtgcaggcgggcggcaaaacgcggctatcgggcatgattcac
ggtgttttgctgctgctggtgatgctggggctgggcaggctgacggagccgattcccaat
gcagtgctggcgggaatcttgatcaaagtcgggattgacatcatcgactggagctttttg
cggcgggcgcatcggctgtcgctgaaggcaacggggctgatgtatggcgtgctgtttctg
acggtgtttgtagacctgattacggcggtggcggtgggcgtgtttttcgcgaatctgctc
actgtgaaaagcctgagtgacttgcagagcaagcgcgtccgtgcgattattcacccgaca
gacgaagcgctggctccagaagaacagaccttgttggaagctggtcagggtcggatcatg
ctgttccaactcagcgggcccatgagctttggcgcggcaaaggcaatttcgcagcagatg
acgctggtgcaagagtatgacgtgctaattctggatttgacggaagtgccgcgactgggg
gtgacggcggcgctggcgattgaggcgatggtgcaggaggcctgtcggcagcgacgggag
gtgcttttggtgggcgtggaaggcagcgtgcgcgatcgcctccagcggctcaacctgctg
aacgccatggacgaaaatcatgtgtttcctacgcgcctgtctgcgctgcaacgggcgatc
gccctagttatccccccgaagcaggaattagaggttagaagttaa
DBGET
integrated database retrieval system