Tannerella serpentiformis: BCB71_01600 Help Entry BCB71_01600       CDS       T04474                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism toh  Tannerella serpentiformis Pathway toh00030   Pentose phosphate pathway toh00051   Fructose and mannose metabolism toh00710   Carbon fixation by Calvin cycle toh01100   Metabolic pathways toh01110   Biosynthesis of secondary metabolites toh01120   Microbial metabolism in diverse environments toh01200   Carbon metabolism toh01230   Biosynthesis of amino acids Module toh_M00004   Pentose phosphate pathway (Pentose phosphate cycle) toh_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:toh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BCB71_01600 (rpiB)    00051 Fructose and mannose metabolism     BCB71_01600 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BCB71_01600 (rpiB) Enzymes [BR:toh01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BCB71_01600 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB DUF2000 Motif Other DBs NCBI-ProteinID:  AOH41841 LinkDB All DBs Position 397546..398001 Genome browser AA seq 151 aa AA seqDB search MSAMDTQPLPIGFACDHAGLEIKRALMKHVAELGYEVRDFGTDTSDSCDYPDYAHPLAEA VEAGAVYPGIGLCGSGNGIGMTLNKHQSIRAALCWNDETARLSRAHNDANVLVLPARFVT VEEAMRMVDIFLSTTFDGGRHRRRVEKIPVV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgatggacacacaacctttaccgataggttttgcctgtgatcacgcgggcttg gagattaagcgtgcactcatgaagcacgtggccgagttaggttacgaggtgcgtgacttt ggtacggatacgtctgacagttgcgattatcccgactacgcccacccgctggccgaggct gtggaggcgggcgccgtctatcccggcattggcctctgtggttcgggtaacggcatcggc atgacgctcaacaagcaccaaagcatccgtgcggcgctctgctggaacgacgagacggcg cgcctctcgcgtgcccacaacgatgcaaacgtgctcgttctgcccgcacgcttcgtgacc gtcgaggaagccatgcgcatggtcgacatcttcctctcgaccaccttcgacggcggccgc catcgccgccgcgtggagaagatcccggtggtgtaa

DBGET integrated database retrieval system