Tolypothrix sp. PCC 7601: HG267_08735 Help Entry HG267_08735       CDS       T11260                                  Name (GenBank) cytochrome b559 subunit beta   KO K02708   photosystem II cytochrome b559 subunit beta Organism toi  Tolypothrix sp. PCC 7601 Pathway toi00195   Photosynthesis toi01100   Metabolic pathways Module toi_M00161   Photosystem II toi_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:toi00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     HG267_08735  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:toi00194]     HG267_08735 Photosynthesis proteins [BR:toi00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     HG267_08735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 MFS_2 Motif Other DBs NCBI-ProteinID:  UYD35822 LinkDB All DBs Position complement(2103595..2103732) Genome browser AA seq 45 aa AA seqDB search MTSGNNINQPVTYPIFTVRWLAVHTLGVPTVFFLGAIAAMQFIQR NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgactagcggcaacaacatcaatcaaccagttacctatcccatctttacagttagatgg ttggcggttcacaccctaggtgtacctactgtcttcttcttgggcgcgatcgccgcaatg cagtttattcaacgctag

DBGET integrated database retrieval system