Thalassolituus oleivorans MIL-1: TOL_1649 Help Entry TOL_1649          CDS       T02529                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tol  Thalassolituus oleivorans MIL-1 Pathway tol01100   Metabolic pathways tol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TOL_1649    00074 Mycolic acid biosynthesis     TOL_1649   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TOL_1649 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  CCU72073 UniProt:  M5DRG1 LinkDB All DBs Position 1775416..1775649 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVCEQLGAKEEDVKASSSFVDDLGADSLDTVELVMALEEEFETEIPDEHA EKLTTVQEAIDYIIANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaatatcgaagaacgtgtaaagaaaattgtatgtgaacagctaggcgcaaaagaa gaagacgtaaaagcttcatcttctttcgttgatgatcttggtgcagattcactagacact gttgagctggtaatggctttggaagaggaattcgaaaccgaaatccctgacgagcacgca gagaagctgactaccgttcaggaagcaatcgactacatcattgccaatctgtaa

DBGET integrated database retrieval system