Thalassolituus oleivorans MIL-1: TOL_3612 Help Entry TOL_3612          CDS       T02529                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism tol  Thalassolituus oleivorans MIL-1 Brite KEGG Orthology (KO) [BR:tol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tol03036]     TOL_3612 Chromosome and associated proteins [BR:tol03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     TOL_3612 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NRBF2 ZapB TPR_MLP1_2 Rootletin DASH_Dam1 DUF724 Motif Other DBs NCBI-ProteinID:  CCU73997 UniProt:  M5DVX9 LinkDB All DBs Position 3792706..3792918 Genome browser AA seq 70 aa AA seqDB search MQESELKKLQRKIEKLLAIHDSLREQNRAMRISEASWQAERAKLVQQNEMARRKVNEMIT RLQTLERNSG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcaagaatcagaactaaaaaaactgcagcgcaaaattgaaaagctgctagcaatacac gactcattacgtgagcaaaatcgtgctatgcgtatttccgaagcaagctggcaagctgaa cgcgccaagctagtacagcaaaatgaaatggctcgccgcaaggtgaacgaaatgattacc cgcctgcaaacgctggagcgcaatagtggctaa

DBGET integrated database retrieval system