Tateyamaria omphalii: BWR18_05170 Help Entry BWR18_05170       CDS       T04652                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tom  Tateyamaria omphalii Pathway tom01100   Metabolic pathways tom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWR18_05170    00074 Mycolic acid biosynthesis     BWR18_05170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWR18_05170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  APX11149 UniProt:  A0A1P8MT61 LinkDB All DBs Position 1047903..1048136 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEEKVSENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVGFITKAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgccgatcgcgtgaagaagatcgttgtggaacacttgggtgtggacgaa gaaaaggttagcgaaaacgcgtccttcatcgacgatctgggcgcagacagcctggacacc gtggaactggtgatggcgttcgaagaagaattcgggatcgagatccccgatgacgcggcc gaaaccatccagactttcggcgacgcagtgggcttcatcaccaaagcctcgtaa

DBGET integrated database retrieval system