Tateyamaria omphalii: BWR18_14920
Help
Entry
BWR18_14920 CDS
T04652
Name
(GenBank) glycosyl transferase
Organism
tom
Tateyamaria omphalii
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transgly
Transpeptidase
Motif
Other DBs
NCBI-ProteinID:
APX12835
UniProt:
A0A1P8MXL9
LinkDB
All DBs
Position
complement(2990087..2992270)
Genome browser
AA seq
727 aa
AA seq
DB search
MRDSRKGKRPLVADRRYPKKKTAKPAARKAPAKRRKPPARKPSRNIFVRLFKWVLRLVWW
ITWRVGLTVTAAVALAVGYFWTTLPDVNELLDGRARGSVTLLDREGNRFAWRGDQFGGVV
MASTVAPGLKNAVIATEDKRFYRHFGVSPRGVASAVRINLREGRGPLQGHGGSTITQQTA
KLLCLGVVYDPAEWKSEAAYVSDCRRGSIQRKAKEAIYAMAMEVKYSKEEILSIYLNRAY
MGAGAYGAEAAAQRFFGKSAATLTPSEGAMIAGLLTAPSRLAPTSNLERSRDRAATVLRL
MGEQGYLTQAEVAQWQQNPASLSPAARRKAGGYFADWVMSTGPEFFTRNTTEDVIIRTTL
DQRLQRAAEEALKQVFETKVREGSKAQAAIVVMSADGAVRAMVGGRETRVAGVFNRAIQA
QRQTGSAFKPFVYAAALELGYSPLDTVIDEPMTLNIPGSGAWSPRNYTNTYSGQVTLIQA
LAQSLNIPAVKVSESVGRELVRRIATDFGINNEMAQGPALALGASESTLLDMTGAYAGIL
NGGSSVTPYGLIDLRLQGDDAPLMGTGGGIGERVVQDQAAAQLIWMMEKVVSEGTGARAQ
FGGREIAGKTGTTQAARDAWFVGFTADYVAGVWMGYDDNTPLTGVTGGGLPAEIWRETMV
RVHEGVPAKPLPMQAPVGATRPDPAPQTPRDDVPRTTEGLIEMLIRDVLGGGGEPTRPND
RIPGESR
NT seq
2184 nt
NT seq
+upstream
nt +downstream
nt
atgcgtgattcaagaaagggcaaacgccctttggtggcggaccgtcgctatccaaaaaag
aagacggccaaaccggcggcccgcaaggcgccggccaagcggcgcaagccgcccgcgcgg
aaaccgtcgcgcaacatctttgtccgccttttcaagtgggtactccgccttgtctggtgg
attacatggcgcgtcggcctgaccgtgacagcagcggtcgcgttggccgtcggctatttc
tggaccacacttcccgacgtgaacgagctgctggatggccgcgcccgcggctctgtcacc
ctgcttgaccgcgaaggaaaccgctttgcctggcggggcgatcagttcggtggggtcgtg
atggccagcaccgtggcgcccggcctaaagaacgctgtcatcgcgaccgaggacaagcgc
ttctaccgccatttcggcgtcagtccgcgcggtgttgccagtgcggtgcgcatcaacctg
cgcgaagggcgcgggccactgcagggtcacggcggctcgaccatcacgcagcagacggcg
aaactgctgtgtcttggcgtcgtctatgatccggcggaatggaagtccgaagcggcctat
gtctccgattgccgtcgcgggtcgatccagcgcaaggccaaggaagccatctatgcgatg
gcgatggaggtgaagtactccaaggaggagatcctctcgatctacctcaaccgggcctac
atgggcgcaggtgcctacggggccgaagccgcggcacagcgctttttcggcaaatccgcg
gccaccctgaccccgtccgagggcgcgatgatcgcggggcttctgacagcgccctcgcgc
cttgctcccacatccaacttggaacggtcccgcgatcgcgcggcgaccgtgctgcggctg
atgggggaacagggatacctcacgcaggccgaggtcgcgcaatggcagcagaacccggcc
agcctgtcgccggcagcgcggcgcaaggcgggcggttactttgccgattgggtcatgtcg
acagggcccgaattcttcacccgcaacacgaccgaagatgtcatcatccgcaccaccctc
gaccagcgcttgcaacgcgccgccgaagaggcgctgaaacaggtgttcgaaaccaaggtg
cgcgaaggctccaaggcacaggccgccatcgtggtgatgagcgcggacggcgccgtgcgg
gccatggtgggtggccgcgaaacgcgggtcgcgggagtgttcaaccgcgcgatccaggcg
cagcggcagacgggctctgccttcaagccctttgtctatgcggccgccctggaacttggg
tattccccgctggatacggtcatcgacgagccgatgacgcttaatatccccggctcgggc
gcgtggtccccgcgcaattacaccaacacgtattcgggccaggtgacgctgatccaggcg
ctggcgcaatcgctgaacattccggcagtgaaagtgtcggaaagtgtggggcgcgaactg
gtgcgccggatcgcgactgatttcggcatcaacaacgagatggcccaaggccccgcgctg
gccttgggtgcgtcggaaagcacgcttttggacatgaccggggcgtatgcgggcatcctt
aacggcggttcctccgtcacgccctacggtttgatcgacctgcggcttcagggcgatgat
gcgccgctgatgggtacgggcggcgggataggcgagcgcgtggtgcaggatcaggcggcg
gcccagttgatctggatgatggaaaaggtggtgagcgaaggcacgggtgcacgggcgcag
ttcggtgggcgcgagatcgcgggcaagactggcacgacccaggccgcccgcgatgcgtgg
tttgtcgggtttacggcggactacgtggccggtgtctggatggggtatgatgacaatacg
ccactcacgggtgtcacaggcggtgggctgcccgctgaaatctggcgggagacgatggtg
cgggtgcacgaaggggtgcccgccaagccgttgccgatgcaggctccggttggtgcgacg
cgcccggatcccgcgccgcagacacctcgggacgacgtgccgcgcacgaccgaagggctt
atcgagatgcttatacgggatgttttgggtggcgggggggagcccacccgccccaacgac
cgaattccgggcgaaagccgctag
DBGET
integrated database retrieval system