KEGG   Tateyamaria omphalii: BWR18_15100
Entry
BWR18_15100       CDS       T04652                                 
Name
(GenBank) ABC transporter
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
tom  Tateyamaria omphalii
Pathway
tom02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tom00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWR18_15100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tom02000]
    BWR18_15100
Enzymes [BR:tom01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     BWR18_15100
Transporters [BR:tom02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    BWR18_15100
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_15 AAA_16 AAA_30 AAA_23 nSTAND1 ORC-CDC6-like AAA_22 nSTAND3 SMC_N AAA_25 RsgA_GTPase MMR_HSR1 AAA_27 NACHT AAA_28 Mg_chelatase
Other DBs
NCBI-ProteinID: APX13919
UniProt: A0A1P8N182
LinkDB
Position
3026410..3027168
AA seq 252 aa
MDFAPVSPVDIEARGVAKRFGETPIFSDVSFRLARGEAVALVGANGAGKSTLLRCLMGLI
PVSGGSVHLLGQETNAIKARALRDVRSQVGLVSQKHNLVPRLSVLSNVVHGLLGTSPGLR
HWSHVLAPEMSRRAALHALDRVGMAGFAQRRADRLSGGQSQRVAIARAIVAAPKVLFADE
PCASLDPSAGADVMDLLFRLVRDQGVTVVFTSHNIDHALKYGNRVLGLAHGRLQLDATAA
SLVAQDLRGLYD
NT seq 759 nt   +upstreamnt  +downstreamnt
gtggatttcgcgccggtatcgcccgtcgacatcgaggcgcgcggggtcgcaaaacgcttt
ggcgaaacgccgattttctcggatgtgagttttcgactggcgcggggtgaggctgtggcg
cttgtcggagccaacggcgccggcaagtccaccctgctgcgctgcctgatggggttgatc
ccggtcagcggcggcagcgttcacctgctgggccaagagaccaacgccatcaaggcgcgg
gcgctgcgcgacgtgcggtcccaggttggcctcgtgtctcagaagcacaacctcgtgccg
cgcctgtctgtcctgtcgaacgtggtgcatgggctgcttggcacgtcgccgggtctacgc
cattggagccatgttctggccccggagatgtcacgcagggcggccctgcacgcgctggac
cgggttggcatggcgggctttgcccagcggcgcgcggatcgtctttccggcggacaatca
cagcgggtcgccattgcccgcgcgatcgtagcggcgcccaaggtgctctttgcagacgaa
ccctgcgcatcgcttgacccgtccgccggcgcggatgtgatggacctgttgtttcggctg
gtccgcgaccaaggggtcacggttgtgttcacgtcccacaatatcgaccacgcgctgaaa
tatggaaaccgcgtgctgggcttggcgcacgggcgcctacagcttgatgcaaccgccgcg
tccctggtcgcgcaggatcttcgggggctttatgactga

DBGET integrated database retrieval system