Tateyamaria omphalii: BWR18_16735 Help Entry BWR18_16735       CDS       T04652                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tom  Tateyamaria omphalii Brite KEGG Orthology (KO) [BR:tom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tom03110]     BWR18_16735 Chaperones and folding catalysts [BR:tom03110]  Protein folding catalysts   Protein disulfide isomerase    BWR18_16735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like DUF1223 SH3BGR GST_N Motif Other DBs NCBI-ProteinID:  APX13145 UniProt:  A0A1P8MYH8 LinkDB All DBs Position 3338567..3338824 Genome browser AA seq 85 aa AA seqDB search MKAVEIYTSPLCGFCHAAKRLLKEKGVEFSEVNVLAQPGRKAEMIQRANGGRTVPQIFIG DTHVGGCDDLYALDGAGKLDALLAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaagccgtcgaaatctacacctcgcccttgtgcggcttttgccatgccgcaaaacgt ctgctcaaagaaaagggtgtggagttctctgaagtgaacgtcctggcccaaccgggtcgc aaggccgagatgatccagcgggcgaacggaggtcggacggtgcctcagatatttatcggc gacacgcatgtgggcgggtgcgacgatctctatgccctggatggcgcgggcaagcttgat gcgcttcttgcgtcctga

DBGET integrated database retrieval system