Thermococcus onnurineus: TON_0113 Help Entry TON_0113          CDS       T00789                                  Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ton  Thermococcus onnurineus Pathway ton03010   Ribosome Brite KEGG Orthology (KO) [BR:ton00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TON_0113   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TON_0113  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ton03011]     TON_0113    04121 Ubiquitin system [BR:ton04121]     TON_0113 Ribosome [BR:ton03011]  Ribosomal proteins   Eukaryotes    Large subunit     TON_0113   Archaea     TON_0113 Ubiquitin system [BR:ton04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TON_0113 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Zn_ribbon_RPAB4 DZR Ribosomal_L40e Toxin_5 DZR_2 Zn_ribbon_10 Zn_ribbon_3 HypA Motif Other DBs NCBI-ProteinID:  ACJ15598 UniProt:  B6YSR1 LinkDB All DBs Position 89168..89326 Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattcccggaggctgaggccaggatatttaggaagtacatctgcatgcgctgc ggtgccactaacccgtggaaggcaaagaagtgcaggaagtgcggctacaagggccttcgc ccgaaggctagggagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system