Thermococcus onnurineus: TON_0185 Help Entry TON_0185          CDS       T00789                                  Name (GenBank) archaeal histone A   KO K24450   DNA-binding protein Organism ton  Thermococcus onnurineus Brite KEGG Orthology (KO) [BR:ton00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ton03036]     TON_0185 Chromosome and associated proteins [BR:ton03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     TON_0185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TFIID-31kDa CENP-S TAF Bromo_TP TFIID_20kDa TFIID-18kDa DUF1931 CENP-X PE LonB_AAA-LID TIP49_C PCP_red Motif Other DBs NCBI-ProteinID:  ACJ15670 UniProt:  B6YSY3 LinkDB All DBs Position 160492..160695 Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEEAAKVLAEYLEEYAMDLAKRAAEFARHAGRKTVKAED IKLAIKT NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccgattgccccgattgacaggctgattagaaaggccggtgctgagagg gtcagcgaggaggctgccaaggtcctcgccgagtacctcgaggagtacgctatggatctt gctaagagagccgccgagttcgccaggcacgctggcaggaagaccgtcaaggccgaggac atcaagctcgctatcaagacctga

DBGET integrated database retrieval system