Thermococcus onnurineus: TON_1909 Help Entry TON_1909          CDS       T00789                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ton  Thermococcus onnurineus Pathway ton03010   Ribosome Brite KEGG Orthology (KO) [BR:ton00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TON_1909   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TON_1909  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ton03011]     TON_1909    04121 Ubiquitin system [BR:ton04121]     TON_1909   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ton04147]     TON_1909 Ribosome [BR:ton03011]  Ribosomal proteins   Eukaryotes    Small subunit     TON_1909   Archaea     TON_1909 Ubiquitin system [BR:ton04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TON_1909 Exosome [BR:ton04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TON_1909   Exosomal proteins of colorectal cancer cells    TON_1909 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Cas12f1-like_TNB Zn_ribbon_IS1595 Lar_restr_allev Zn_ribbon_RPB9 Zn_ribbon_NUD MqsA_antitoxin GFA Zn_ribbon_Nudix Zn_Ribbon_1 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ACJ17400 UniProt:  B6YW34 LinkDB All DBs Position complement(1800169..1800324) Genome browser AA seq 51 aa AA seqDB search MGQKWKLYEVQGGKVKRKNKFCPRCGPGVFMAEHKDRWSCGRCGYTEWKRK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgggacagaagtggaagctctatgaggttcagggcggtaaggtcaagaggaagaacaag ttctgcccgcgctgtggtccgggtgtcttcatggccgagcacaaggaccgctggagctgc ggaaggtgcggctacaccgaatggaagaggaagtga

DBGET integrated database retrieval system