Thermodesulfobacterium geofontis: TOPB45_0016 Help Entry TOPB45_0016       CDS       T01547                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism top  Thermodesulfobacterium geofontis Pathway top01100   Metabolic pathways top01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:top00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TOPB45_0016    00074 Mycolic acid biosynthesis     TOPB45_0016   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TOPB45_0016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 DUF2096_N Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEH22133 UniProt:  F8C1R4 LinkDB All DBs Position complement(13421..13660) Genome browser AA seq 79 aa AA seqDB search MSVEEKVIEIISQKLNLSKDQIKPEASFVDDLGADSLDLVELVMAMEEAFGMEVPDEEAE KLRTVKDVIEYIKAKTGEQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcagtagaggaaaaagttattgagattatttctcaaaaattaaatctttcaaaagat cagattaaacctgaagcatcatttgtagatgatttaggagcggattctcttgatcttgtt gaacttgttatggctatggaagaggcttttggaatggaggttcctgatgaagaagctgaa aaattaagaacagttaaggatgttatagaatatataaaagccaaaacaggggaacaataa

DBGET integrated database retrieval system