Tolypothrix sp. PCC 7910: HCG51_32460 Help Entry HCG51_32460       CDS       T06504                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism toq  Tolypothrix sp. PCC 7910 Pathway toq00998   Biosynthesis of various antibiotics toq01100   Metabolic pathways toq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:toq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HCG51_32460 (acpP)    00074 Mycolic acid biosynthesis     HCG51_32460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HCG51_32460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N LAMB4 DUF1493 Motif Other DBs NCBI-ProteinID:  QIR40932 UniProt:  A0A6G9SNK6 LinkDB All DBs Position complement(8104961..8105212) Genome browser AA seq 83 aa AA seqDB search MSQAETFDRVKKVVVDQLGVEADTIKPQSTFIDDLGADSLDIVELVMAFEEEFDIEIPDE SAEKILSVQDAVDYINSKAAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcggaaacttttgacagagtcaagaaagtcgttgtcgatcaactaggtgtt gaggccgatactatcaaaccacaatctacatttattgatgatttaggagctgactcctta gatatcgtggagttagtaatggcttttgaagaagaatttgatattgaaattcccgatgaa tccgctgaaaagattttatcggttcaagatgcagtggattatatcaacagcaaggctgct gcgtctgcctga

DBGET integrated database retrieval system