Thalassolituus oleivorans R6-15: R615_06605 Help Entry R615_06605        CDS       T03056                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism tor  Thalassolituus oleivorans R6-15 Pathway tor01100   Metabolic pathways tor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R615_06605    00074 Mycolic acid biosynthesis     R615_06605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R615_06605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHK17460 LinkDB All DBs Position complement(1416920..1417150) Genome browser AA seq 76 aa AA seqDB search MSMLERLKSTVSSITQADYTDVAADQALNLDSIHRISLIVALEEEFDIEIDSDELGSEMF DTFEQMGKFIETCIAQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccatgctagagcgcttaaaatcgactgtctcaagcataacgcaagctgattatacg gatgtggcagctgatcaagctctcaatttagattctatccaccgcatttctttaatcgtc gcgctggaagaagaatttgatatcgaaattgacagtgatgaattaggttcagaaatgttc gatacatttgaacaaatgggtaaattcatcgaaacctgcattgctcaatag

DBGET integrated database retrieval system