Thalassolituus oleivorans R6-15: R615_09300 Help Entry R615_09300        CDS       T03056                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tor  Thalassolituus oleivorans R6-15 Pathway tor01100   Metabolic pathways tor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R615_09300 (acpP)    00074 Mycolic acid biosynthesis     R615_09300 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R615_09300 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AHK15932 LinkDB All DBs Position complement(1970539..1970772) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVCEQLGAKEEDVKASSSFVDDLGADSLDTVELVMALEEEFETEIPDEHA EKLTTVQEAIDYIIANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgtgtaaagaaaattgtatgtgaacagctaggcgcaaaagaa gaagacgtaaaagcttcatcttctttcgtcgatgatcttggtgcagattcactagacact gttgagctggtaatggctttagaagaggaattcgaaaccgaaatccctgacgagcacgca gagaagctgactaccgttcaggaagcaatcgactacatcattgccaatctgtaa

DBGET integrated database retrieval system