Thermus oshimai: Theos_0670 Help Entry Theos_0670        CDS       T02346                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tos  Thermus oshimai Pathway tos01100   Metabolic pathways tos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Theos_0670    00074 Mycolic acid biosynthesis     Theos_0670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Theos_0670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFV75732 UniProt:  K7RGN2 LinkDB All DBs Position complement(617187..617429) Genome browser AA seq 80 aa AA seqDB search MSEQEIFEKVKAVIADKLSVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVEYIKAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcaggagatctttgaaaaggtgaaggcggttatcgcggacaagctctccgtg gagccggagaaggtgaccctcgaggcccgcttcattgaggacctgggggcggacagcctg gacacggtggagctcatcatgggcctggaggacgagttcggcctggagatctccgacgag gaagcggaaaagatccgcaccgtcaaggacgcggtggagtacatcaaggccaagctgggc taa

DBGET integrated database retrieval system