Treponema paraluiscuniculi L2: TPLL2_0974 Help Entry TPLL2_0974        CDS       T09221                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism tpaa  Treponema paraluiscuniculi L2 Pathway tpaa02020   Two-component system tpaa02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:tpaa00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     TPLL2_0974  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     TPLL2_0974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:tpaa02035]     TPLL2_0974 Bacterial motility proteins [BR:tpaa02035]  Flagellar system   Flagellar assembly proteins    Others     TPLL2_0974 SSDB OrthologParalogGFIT Motif Pfam:  FlgM Val_tRNA-synt_C HVO_2525_N Motif Other DBs NCBI-ProteinID:  WKC72827 UniProt:  A0ABY9E2K2 LinkDB All DBs Position complement(1052462..1052740) Genome browser AA seq 92 aa AA seqDB search MIDKLSGLDPVQNLRASCASEHVARAPAGDEITVSAEAQKKAELYLALEAVRSAPDVREY KIAAAEQKLADPAYLERALSHVVERFLEEQNL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgatcgataagctaagtggacttgatccggttcagaaccttcgcgcctcttgtgcgtct gagcatgtggcgcgtgctccagccggcgatgagattactgtctctgcggaagcccagaaa aaggctgagttgtacttggccctggaggcggtacgttctgcgcctgatgtgcgtgaatac aaaatagcagctgcggagcagaagcttgcagaccctgcgtatctggagcgggcgctgtcc cacgtggtggagcgcttcctggaggagcagaatttataa

DBGET integrated database retrieval system