Thermococcus pacificus: A3L08_03360 Help Entry A3L08_03360       CDS       T05192                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tpaf  Thermococcus pacificus Pathway tpaf03010   Ribosome Brite KEGG Orthology (KO) [BR:tpaf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L08_03360   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L08_03360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tpaf03011]     A3L08_03360    04121 Ubiquitin system [BR:tpaf04121]     A3L08_03360   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpaf04147]     A3L08_03360 Ribosome [BR:tpaf03011]  Ribosomal proteins   Eukaryotes    Small subunit     A3L08_03360   Archaea     A3L08_03360 Ubiquitin system [BR:tpaf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L08_03360 Exosome [BR:tpaf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    A3L08_03360   Exosomal proteins of colorectal cancer cells    A3L08_03360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_11 Zn_ribbon_IS1595 Zn_ribbon_RPB9 Zn_ribbon_NUD GFA MqsA_antitoxin Zn_ribbon_Nudix Zn_Ribbon_1 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ASJ06436 UniProt:  A0A218P6M2 LinkDB All DBs Position complement(617726..617908) Genome browser AA seq 60 aa AA seqDB search MTKGKGGKKTSQKWKMYEVQGGKVKRKNKFCPRCGPGVFMAEHKDRWSCGRCGYTEWKRK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgaccaagggtaagggcggtaagaagaccagccagaagtggaagatgtacgaggttcag ggcggaaaggtcaagaggaagaacaagttctgcccgcgctgcggtccgggcgtcttcatg gccgagcacaaggaccgctggagctgcggccgctgcggctacaccgagtggaagaggaag tga

DBGET integrated database retrieval system