Thrips palmi (melon thrips): 117646429 Help Entry 117646429         CDS       T08251                                  Name (RefSeq) 12 kDa FK506-binding protein   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism tpal  Thrips palmi (melon thrips) Brite KEGG Orthology (KO) [BR:tpal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tpal03110]     117646429 Enzymes [BR:tpal01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      117646429 Chaperones and folding catalysts [BR:tpal03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     117646429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  117646429 NCBI-ProteinID:  XP_034243240 UniProt:  A0A6P8YZY2 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MGVEIETTRAGDGQTYPKTGQTVVVHYTGTLTSGQKFDSSRDRGVPFKFRLGKGEVIKGW DEGFAQLCVGEKARLTCSPDYAYGARGHPGIIPPNATLIFDVELLKVEP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgggcgttgaaatcgagacaacccgggccggcgatggccagacctaccccaagaccggg cagacagttgtggtccactacacaggtactctcacaagtgggcagaaatttgactcctcc agggatcggggagtaccattcaagttccgcttgggcaagggagaggtcatcaaaggctgg gatgagggttttgcccagctctgcgttggtgagaaagctcgcctcacttgctcacctgac tacgcctatggagcccgcggtcatcctggcatcatcccaccaaacgccactctcatcttc gatgtggaattgttgaaggtggaaccatga

DBGET integrated database retrieval system