Thrips palmi (melon thrips): 117647772 Help Entry 117647772         CDS       T08251                                  Name (RefSeq) elongin-B-like isoform X1   KO K03873   elongin-B Organism tpal  Thrips palmi (melon thrips) Pathway tpal04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tpal00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117647772  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpal04121]     117647772    03400 DNA repair and recombination proteins [BR:tpal03400]     117647772 Ubiquitin system [BR:tpal04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117647772    Cul5 complex      117647772 DNA repair and recombination proteins [BR:tpal03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117647772 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  117647772 NCBI-ProteinID:  XP_034245569 UniProt:  A0A6P8ZQB6 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MQMSNSMLFPFLQDVFLMIRRKKLTIFTDAKDSTTVLELKKMIEGIIKVSPENQQLFNKD NVEMDDHRALQDYGLTASSAKAQCPAQIGLAVRGEDGSFEQLEMTPYSSPPDLPDVMKNS EANGAELPS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgcaaatgagtaatagtatgttatttccatttttacaggatgtctttctcatgattaga agaaagaagctaacgatatttaccgatgctaaggactccactactgtactggaactaaag aaaatgatagaaggcattattaaagtctcacctgaaaaccagcaactttttaacaaagat aatgttgaaatggatgaccacagagcattacaagactatggcttgactgctagttctgcc aaggctcaatgccccgctcaaattgggcttgctgttaggggagaagatggcagctttgaa cagttggagatgaccccctactcatccccacctgatctgccagatgtaatgaaaaactca gaagcaaatggtgcggaactgccgtcctga

DBGET integrated database retrieval system