Thrips palmi (melon thrips): 117648016 Help Entry 117648016         CDS       T08251                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism tpal  Thrips palmi (melon thrips) Pathway tpal04013   MAPK signaling pathway - fly tpal04068   FoxO signaling pathway tpal04137   Mitophagy - animal tpal04140   Autophagy - animal tpal04150   mTOR signaling pathway tpal04213   Longevity regulating pathway - multiple species tpal04214   Apoptosis - fly tpal04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:tpal00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     117648016    04068 FoxO signaling pathway     117648016    04150 mTOR signaling pathway     117648016  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117648016    04137 Mitophagy - animal     117648016   09143 Cell growth and death    04214 Apoptosis - fly     117648016  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     117648016   09149 Aging    04213 Longevity regulating pathway - multiple species     117648016  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpal04131]     117648016   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tpal04031]     117648016 Membrane trafficking [BR:tpal04131]  Endocytosis   Macropinocytosis    Ras GTPases     117648016 GTP-binding proteins [BR:tpal04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117648016 BRITE hierarchy Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Septin Aldo_ket_red DUF2951 TPP_enzyme_M FeoB_N Ribosomal_L25p Motif Other DBs NCBI-GeneID:  117648016 NCBI-ProteinID:  XP_034246025 UniProt:  A0A6P8Z6Z0 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIQRVKDAEEVPMVLVGNKCDL QSWNVDMEEARDIAKTYNIPFVETSAKTRMGVDDAFYTLVREIRKDKEQRGKEKRKRLRG VTRRKKCVIL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagttagtggtggttggggcgggaggcgtaggcaagagtgccctcacc atccaactcatccaaaatcattttgtggatgagtatgacccaactattgaagattcgtat cgaaagcaagttgtcatcgatggcgagacgtgtctactggatatccttgacacagccggt caagaagaatatagtgctatgagagatcagtatatgcgtacaggtgaaggctttttgctg gtgtttgcagtgaatagtgctaaatcctttgaagatattggcacttacagggagcaaata caacgtgtaaaagatgcagaggaggtaccaatggttctggttggaaacaagtgtgacctg caatcttggaatgtagacatggaagaagctcgggatattgctaaaacgtacaatattccg tttgttgagacctctgcaaaaactcgtatgggtgttgatgatgctttctatacactggta cgggaaatcagaaaggataaagaacaaagaggcaaagagaagcgtaagcggttgagaggt gttacaaggcgcaagaagtgtgttattttgtga

DBGET integrated database retrieval system