Thrips palmi (melon thrips): 117653700 Help Entry 117653700         CDS       T08251                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism tpal  Thrips palmi (melon thrips) Pathway tpal04137   Mitophagy - animal tpal04140   Autophagy - animal tpal04144   Endocytosis tpal04145   Phagosome tpal04148   Efferocytosis Brite KEGG Orthology (KO) [BR:tpal00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117653700    04145 Phagosome     117653700    04140 Autophagy - animal     117653700    04137 Mitophagy - animal     117653700    04148 Efferocytosis     117653700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpal04131]     117653700   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpal04147]     117653700    04031 GTP-binding proteins [BR:tpal04031]     117653700 Membrane trafficking [BR:tpal04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     117653700 Exosome [BR:tpal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117653700   Exosomal proteins of other body fluids (saliva and urine)    117653700   Exosomal proteins of colorectal cancer cells    117653700   Exosomal proteins of bladder cancer cells    117653700 GTP-binding proteins [BR:tpal04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     117653700 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 FLYWCH_N G-alpha NTPase_1 AAA_5 AAA_7 AAA_16 Septin AAA_22 cobW AAA_24 NB-ARC PduV-EutP ATPase_2 AAA_14 SRPRB FeoB_N NACHT ATP-synt_ab Motif Other DBs NCBI-GeneID:  117653700 NCBI-ProteinID:  XP_034255434 UniProt:  A0A6P9AD57 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MASRKKVLLKVIILGNSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVGDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKALDSWRDEFLIQASPRDPENFPF VVLGNKCDMESRVVSTKRAQQWCFSKNNIPYFETSAKEALNVEQAFQTIAKNALEQESEV ELYPEFPDPIKLNSENRGSRQDGCGC NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaggaaaaaggtactcctgaaagtgatcattcttggcaattctggagttggt aagacatcccttatgaaccagtatgtcaacaagaagttctctaaccagtacaaggccacc attggagctgattttctcaccaaagaagttatggttggtgacagagtggtgacaatgcaa atttgggacactgctggtcaagaaaggtttcaatcgctgggtgttgccttctatcgagga gcagattgctgtgtgttagttttcgatgtaactgcacccaacacatttaaagctttggat agctggcgagacgagttccttatccaagcgtctccaagagacccagagaacttcccattt gttgtgcttggcaacaagtgtgacatggagagcagagtggtatccaccaagagggctcag cagtggtgctttagcaagaacaacattccctactttgagactagtgcgaaggaggcgttg aatgtggaacaagcattccagaccattgccaagaatgcattggagcaagaatctgaagtt gagctgtatcctgagttccctgacccgattaagttgaattccgagaaccgtgggtcaagg caggatggctgtggctgttaa

DBGET integrated database retrieval system