Thermus parvatiensis: AV541_08630 Help Entry AV541_08630       CDS       T04274                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpar  Thermus parvatiensis Pathway tpar01100   Metabolic pathways tpar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AV541_08630    00074 Mycolic acid biosynthesis     AV541_08630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AV541_08630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AMA76000 UniProt:  H7GF34 LinkDB All DBs Position 1582629..1582871 Genome browser AA seq 80 aa AA seqDB search MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVEYIKAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggagcaggagatctttgagaaggtgaaggcggtgatcgcggacaagctccaggtg gagccggagaaggtgaccctcgaggcccgcttcattgaggacctgggggccgattccctg gacacggtggagctcatcatgggcctggaggacgagttcggcctggagatctccgacgag gaggccgagaagatccgcaccgtcaaggacgccgtggagtacatcaaggccaagctgggc taa

DBGET integrated database retrieval system