Thermoanaerobacter pseudethanolicus: Teth39_1286 Help Entry Teth39_1286       CDS       T00649                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpd  Thermoanaerobacter pseudethanolicus Pathway tpd01100   Metabolic pathways tpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Teth39_1286    00074 Mycolic acid biosynthesis     Teth39_1286   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Teth39_1286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  ABY94940 UniProt:  B0K9X7 LinkDB All DBs Position complement(1325957..1326184) Genome browser AA seq 75 aa AA seqDB search MIFEKVRDIIAEQLGIDPEEITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEK IKTVGDVVEYLSNLE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatttttgaaaaagtaagggacataatagccgaacaactcggcattgatccagaggaa ataacgatggagtcatcttttatagatgatttaggagcagactctttggacatagtagag ctcataatggctctggaagaagagtttgatattgaaattcctgatgaagatgctgaaaag attaaaacagtaggtgatgtagtagaatacttaagcaatcttgaataa

DBGET integrated database retrieval system