Thermofilum pendens: Tpen_0211 Help Entry Tpen_0211         CDS       T00446                                  Name (GenBank) nucleoid protein Alba   KO K03622   DNA/RNA-binding protein Alba Organism tpe  Thermofilum pendens Brite KEGG Orthology (KO) [BR:tpe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tpe03036]     Tpen_0211 Chromosome and associated proteins [BR:tpe03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Tpen_0211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Rpp20 Motif Other DBs NCBI-ProteinID:  ABL77621 UniProt:  A1RWP1 LinkDB All DBs Position complement(190722..190997) Genome browser AA seq 91 aa AA seqDB search MSEVGTVFVGNKPVSSYVLAAVTQFTSGSKRVVLKARGRAISRAVDAAELVRRFLGGKVD YGNIKIGSEKVGEPGKERTVSTIEIELVKKE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtcggaagtaggaacagtcttcgtcggtaacaagcccgtgagtagctacgtgctagca gcagtgacacagtttaccagtgggagcaagagagtcgtactgaaggcaagagggcgagcg ataagcagggctgtcgacgctgcagagctcgtgagaaggttcctaggtggcaaagtcgac tacggcaacatcaagatcggtagcgagaaggtcggcgagccaggcaaggaaaggactgtc tccaccatagagatagagctcgtaaagaaggagtag

DBGET integrated database retrieval system