Thermofilum pendens: Tpen_0449 Help Entry Tpen_0449         CDS       T00446                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tpe  Thermofilum pendens Pathway tpe03010   Ribosome Brite KEGG Orthology (KO) [BR:tpe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Tpen_0449   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Tpen_0449  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tpe03011]     Tpen_0449    04121 Ubiquitin system [BR:tpe04121]     Tpen_0449   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpe04147]     Tpen_0449 Ribosome [BR:tpe03011]  Ribosomal proteins   Eukaryotes    Small subunit     Tpen_0449   Archaea     Tpen_0449 Ubiquitin system [BR:tpe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Tpen_0449 Exosome [BR:tpe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tpen_0449   Exosomal proteins of colorectal cancer cells    Tpen_0449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT EDR4-like_1st Zn_ribbon_Nudix YhfH DUF7479 TackOD1 Zn_ribbon_RPB9 Ribosomal_L37e Zn_ribbon_3 DUF7838 Zn_ribbon_ACC Zn_ribbon_RanBP zf-tcix Motif Other DBs NCBI-ProteinID:  ABL77858 UniProt:  A1RXC8 LinkDB All DBs Position 407467..407628 Genome browser AA seq 53 aa AA seqDB search MAKVHELYEYDYKTGTIRLKNKKCPRCGSIMAHHLKPVERWHCGKCGYTEYRT NT seq 162 nt NT seq  +upstreamnt  +downstreamnt gtggcgaaagtacacgaactctacgaatacgactacaaaaccgggaccataaggttgaag aacaaaaagtgcccgcgttgcggatccatcatggcccaccacctaaaacccgtcgagcgc tggcactgcggcaaatgcggatatacggagtatagaacttaa

DBGET integrated database retrieval system