Thermococcus peptonophilus: A0127_06770 Help Entry A0127_06770       CDS       T04728                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tpep  Thermococcus peptonophilus Pathway tpep03010   Ribosome Brite KEGG Orthology (KO) [BR:tpep00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A0127_06770   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A0127_06770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tpep03011]     A0127_06770    04121 Ubiquitin system [BR:tpep04121]     A0127_06770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpep04147]     A0127_06770 Ribosome [BR:tpep03011]  Ribosomal proteins   Eukaryotes    Small subunit     A0127_06770   Archaea     A0127_06770 Ubiquitin system [BR:tpep04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A0127_06770 Exosome [BR:tpep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    A0127_06770   Exosomal proteins of colorectal cancer cells    A0127_06770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_IS1595 Ribosomal_L37e Zn_ribbon_RPB9 Zn_ribbon_NUD GFA MqsA_antitoxin Zn_ribbon_Nudix Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AMQ18894 UniProt:  A0A142CVU2 LinkDB All DBs Position 1274805..1274978 Genome browser AA seq 57 aa AA seqDB search MAKGKKRTSQKWKLYEVKGGKVIRKNKFCPRCGPGVFMANHKDRWSCGRCGYTEWKK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggccaagggtaagaagagaaccagccagaagtggaagctctacgaggttaagggtggt aaggtcataagaaagaacaagttctgcccgcgctgtgggccgggtgtcttcatggccaac cacaaggatcgctggtcctgcggaagatgtggttacaccgagtggaagaagtga

DBGET integrated database retrieval system