Thermococcus peptonophilus: A0127_07720 Help Entry A0127_07720       CDS       T04728                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tpep  Thermococcus peptonophilus Pathway tpep03010   Ribosome Brite KEGG Orthology (KO) [BR:tpep00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A0127_07720   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A0127_07720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tpep03011]     A0127_07720    04121 Ubiquitin system [BR:tpep04121]     A0127_07720 Ribosome [BR:tpep03011]  Ribosomal proteins   Eukaryotes    Large subunit     A0127_07720   Archaea     A0127_07720 Ubiquitin system [BR:tpep04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A0127_07720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 DZR Ribosomal_L40e Zn_ribbon_3 UPF0547 Toxin_5 DUF7577 Motif Other DBs NCBI-ProteinID:  AMQ19063 UniProt:  A0A142CWB1 LinkDB All DBs Position 1433234..1433389 Genome browser AA seq 51 aa AA seqDB search MARFPEAEARIFRKLVCMRCGATNPWGAKKCRKCGYKGLRPKAREPRGGGR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcgagattccctgaggctgaggcaaggatctttaggaaactcgtgtgcatgcgctgc ggtgccactaacccttggggcgcaaagaagtgcagaaagtgcggctacaagggccttcgc ccgaaggccagagaaccgcgcggcggagggcgctga

DBGET integrated database retrieval system