Tetrapisispora phaffii: TPHA_0B03490 Help Entry TPHA_0B03490      CDS       T02235                                  Symbol TPHA0B03490 Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tpf  Tetrapisispora phaffii Pathway tpf03060   Protein export tpf04141   Protein processing in endoplasmic reticulum tpf04145   Phagosome Brite KEGG Orthology (KO) [BR:tpf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TPHA_0B03490 (TPHA0B03490)    04141 Protein processing in endoplasmic reticulum     TPHA_0B03490 (TPHA0B03490)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TPHA_0B03490 (TPHA0B03490)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpf04131]     TPHA_0B03490 (TPHA0B03490)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tpf02044]     TPHA_0B03490 (TPHA0B03490) Membrane trafficking [BR:tpf04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TPHA_0B03490 (TPHA0B03490) Secretion system [BR:tpf02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TPHA_0B03490 (TPHA0B03490) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE DUF4295 Motif Other DBs NCBI-GeneID:  11534972 NCBI-ProteinID:  XP_003684453 UniProt:  G8BPT8 LinkDB All DBs Position 2:814081..814308 Genome browser AA seq 75 aa AA seqDB search MSKESKENANSPIEKLAGTPLEFVKEGTQFINKCKKPDTKEYTKIIRAVGLGFVAVGVIG YAIKLIHIPIRYLIV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctaaagaaagcaaagaaaacgctaacagtccaattgaaaaattagctggtacccca ttagaattcgtcaaggaaggtactcagttcataaataaatgtaagaaacctgacaccaag gaatacacaaagatcatcagagctgtcggtttaggttttgttgctgttggtgtcattggt tatgctatcaagttgatccacattccaatcagatacttaattgtttaa

DBGET integrated database retrieval system