Tetrapisispora phaffii: TPHA_0F03120 Help Entry TPHA_0F03120      CDS       T02235                                  Symbol TPHA0F03120 Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism tpf  Tetrapisispora phaffii Pathway tpf03060   Protein export tpf04141   Protein processing in endoplasmic reticulum tpf04145   Phagosome Brite KEGG Orthology (KO) [BR:tpf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TPHA_0F03120 (TPHA0F03120)    04141 Protein processing in endoplasmic reticulum     TPHA_0F03120 (TPHA0F03120)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TPHA_0F03120 (TPHA0F03120)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpf04131]     TPHA_0F03120 (TPHA0F03120)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tpf02044]     TPHA_0F03120 (TPHA0F03120) Membrane trafficking [BR:tpf04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TPHA_0F03120 (TPHA0F03120) Secretion system [BR:tpf02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TPHA_0F03120 (TPHA0F03120) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Cas_Csx9 Motif Other DBs NCBI-GeneID:  11535598 NCBI-ProteinID:  XP_003686227 UniProt:  G8BUK7 LinkDB All DBs Position 6:684605..684850 Genome browser AA seq 81 aa AA seqDB search MSTPPGGQRTVAKRAKAQASKGKADAKQPENQQGGNSILKIYSDEANGLRVDPLVIIFLA VGFIFSVVALHIIAKFTSKIF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcaactcctcctggtggtcaaagaactgtagctaaaagagctaaggctcaagcttct aagggcaaagctgatgctaaacaaccagaaaaccaacaaggtggcaactccatattgaaa atttattcagatgaggctaatggtttaagagttgatccattggttattatatttctagca gttggtttcatcttctctgttgtcgccttgcatattattgctaaatttacaagcaagatc ttttaa

DBGET integrated database retrieval system