KEGG   Treponema pallidum subsp. pertenue Gauthier: TPEGAU_0906
Entry
TPEGAU_0906       CDS       T01750                                 
Name
(GenBank) putative RNA-binding protein
  KO
K06960  uncharacterized protein
Organism
tpg  Treponema pallidum subsp. pertenue Gauthier
Brite
KEGG Orthology (KO) [BR:tpg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    TPEGAU_0906
SSDB
Motif
Pfam: KH_KhpA-B KH_1
Other DBs
NCBI-ProteinID: AEZ60176
UniProt: A0AAU8PY62
LinkDB
Position
988821..989063
AA seq 80 aa
MVTMEEELIAYIARALVDRPGEVTVTKSPGEGLEILQLRVASEDVGKVIGKHGRIARALR
TLLSASAHASQTRYALEIID
NT seq 243 nt   +upstreamnt  +downstreamnt
atggtcacgatggaagaagagctaatcgcctatattgcgcgggcgcttgtggatcgtcct
ggggaggttaccgtcaccaagtctccaggggagggattggagatccttcagttacgtgtt
gcctctgaagatgtagggaaggtcattggcaagcacggcagaattgcgcgcgctctgcgc
acgctcctttctgcgtctgcgcacgcttctcagacgcgttacgctttagagatcatcgac
tag

DBGET integrated database retrieval system