Treponema pallidum subsp. pertenue Gauthier: TPEGAU_0949
Help
Entry
TPEGAU_0949 CDS
T01750
Symbol
oxaA
Name
(GenBank) Oxa1 family cytochrome oxidase biogenesis protein
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
tpg
Treponema pallidum subsp. pertenue Gauthier
Pathway
tpg02024
Quorum sensing
tpg03060
Protein export
tpg03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
tpg00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
TPEGAU_0949 (oxaA)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
TPEGAU_0949 (oxaA)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
TPEGAU_0949 (oxaA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
tpg03029
]
TPEGAU_0949 (oxaA)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
tpg02044
]
TPEGAU_0949 (oxaA)
Mitochondrial biogenesis [BR:
tpg03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
TPEGAU_0949 (oxaA)
Secretion system [BR:
tpg02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
TPEGAU_0949 (oxaA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
60KD_IMP
YidC_periplas
Motif
Other DBs
NCBI-ProteinID:
AEZ60222
UniProt:
A0AAU8PSD7
LinkDB
All DBs
Position
complement(1031666..1033534)
Genome browser
AA seq
622 aa
AA seq
DB search
MKKNMFIAVVLSVLVLVGASFLQELLYPSASSSHSAAEHTLSAVPEETRTQSAHGGAADT
QETTQPAAHPSGQVLVFPESETEERVERTYVARTPLVQVTFTNRGGDILSYQLREHYAAQ
RREYVEMVEQARPDHRAFSLALGDEYAPNVNALFQVKQEIDARGVHSIGFYRSVATQHAD
GTRTPFVLAKRYVFYPDNYMFELHVSLSADVLEEREDSRQGAKVRAVAETNAGPATTVLA
RANGFDFGTASYTLRTPPEIGPERNAADKYEFRTFMVGAGGKAKTYALKRDGREQVDTPV
SWASVSGKYFALIVLPNDADSLKRLVLSAPQAETAVQHHIAFVRRAVAQPAVADVYRVYI
GPCAEQYLSAYNVASRNPYGLERTYIDAVAVSGGILYPLEVLLKWLLRLFYTLIPNWGVA
IILVTIAIKVLFFPLTKRSFIAMQKMQELQPHMQRIQERYKGNTQKIHEEMAKLYREAQY
NPLSGCLPTLVQMPIIFAMYRLFNNYFEFRGAMFIPYWIPDLSLADSVWTLPFALPVTQW
TQMRMLPVLYVVSQIMFSKLTQVPHTEQQKTSMTIMTYVMPLFFFFFFYDAPSGLLVYWT
AMNGVTLVQQLVMKRTANKNKT
NT seq
1869 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaaaatatgtttattgcagtcgtattgtcggtgttagtgcttgtgggagcttcg
ttccttcaggaacttttgtatccgtctgcatcctcctcgcactctgctgcggaacacacc
ctgtcggccgtacctgaggagacgcgcactcaaagtgctcacgggggtgcagcagatacg
caagagaccacgcagcctgctgcgcatccttccggccaggtgctggtgtttcccgaatca
gaaactgaagagcgtgtagagcgcacgtatgtggcccgcaccccgctagtgcaagtgacg
tttaccaatcgtggtggagatattctttcgtatcagttgcgtgagcactatgcggcgcaa
cgacgtgagtacgtagaaatggtggaacaggcacgtccagaccatcgagctttctcgctc
gcgctgggggacgagtatgctccgaatgtgaatgcacttttccaagtaaagcaggagata
gacgcgcgtggcgtgcattccataggtttttaccgcagtgttgccacgcagcatgctgac
ggtacacggactcctttcgtgctggcgaagcgatacgtattctatcctgataattatatg
tttgagttgcacgtttccctgagtgcagacgttctagaggagcgggaagacagccggcaa
ggggcgaaggtgcgcgcggtggcggagacgaatgctggcccagcgactactgttcttgcg
cgggcgaatggctttgactttgggacagcaagttataccctgcgcacaccgcctgagatc
gggcctgagcggaatgcggcggacaagtatgagtttcgcaccttcatggtaggtgcaggt
ggcaaggcgaaaacgtatgctctgaaaagagatggacgtgaacaggtagatacgcctgtc
tcttgggcgagtgtctcgggtaagtactttgcgctcatcgttttgcccaatgatgcggac
agtctgaaaagactagtgctatcggctccccaagctgaaacagctgtgcagcatcacatc
gcgtttgtgcgccgcgctgttgcgcagcctgcggttgcagatgtttatcgtgtgtacatc
ggcccgtgcgcagagcagtatttgagtgcgtacaacgttgcctctcgaaatccctatggg
cttgagcgcacgtatatcgatgcggtggcagtaagcggtggtattctctatccgcttgag
gtgctccttaagtggctcctgcgtttgttttacaccctcattcctaattggggcgtggca
attattttggtgacgattgcaataaaggtgctctttttcccgctgacgaaaaggagcttt
atcgctatgcaaaagatgcaagaactgcagccacacatgcagcgtatccaagagcggtac
aaagggaatacgcagaagatacatgaggaaatggcgaaactctaccgggaagcgcagtac
aatccgctttcaggctgtctcccaacgcttgtacagatgcctattatttttgcgatgtat
cggttattcaataactacttcgagttccgtggtgcgatgtttatcccgtattggattcct
gatctttcgttggcagacagcgtgtggacactgccgttcgcattgccggtgacacagtgg
actcaaatgcgtatgctgccggttttgtatgtagtctctcaaattatgtttagtaagttg
acgcaggtaccgcacacagagcagcaaaaaacatccatgacgattatgacctatgtgatg
ccgttgttctttttctttttcttttatgatgcgccctcgggtcttctagtgtattggacg
gcaatgaacggagtgacgcttgtacagcagttggtgatgaagcgtacggctaacaagaat
aaaacctga
DBGET
integrated database retrieval system