Treponema phagedenis: FUT81_15335 Help Entry FUT81_15335       CDS       T06342                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism tphg  Treponema phagedenis Brite KEGG Orthology (KO) [BR:tphg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tphg03032]     FUT81_15335    03036 Chromosome and associated proteins [BR:tphg03036]     FUT81_15335    03400 DNA repair and recombination proteins [BR:tphg03400]     FUT81_15335 DNA replication proteins [BR:tphg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FUT81_15335 Chromosome and associated proteins [BR:tphg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FUT81_15335 DNA repair and recombination proteins [BR:tphg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FUT81_15335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QEK10674 LinkDB All DBs Position complement(3372486..3372758) Genome browser AA seq 90 aa AA seqDB search MKVTKADLKKHLLQEGCGQAAGEIAEKVIGWITDNIKAGNTIELRGFGTFYTVTVPAHKN RFNPDKTVDERVKVKFRPGKSLQGKELLKK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtaacaaaagcggatttgaaaaaacatcttttacaggaaggctgcggacaagct gcaggtgagattgcggaaaaggttatcggctggattacggataacataaaggcggggaat acgatagagctgcgcgggttcggcacgttttatacggttaccgtaccggcgcataaaaac cgttttaaccccgataaaacggttgatgaacgggtaaaggtaaaatttcgtcccggcaaa agtttacaaggaaaggagcttttgaaaaaatga

DBGET integrated database retrieval system