Treponema primitia: TREPR_2532 Help Entry TREPR_2532        CDS       T01507                                  Name (GenBank) conserved domain protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism tpi  Treponema primitia Pathway tpi03020   RNA polymerase Brite KEGG Orthology (KO) [BR:tpi00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TREPR_2532  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tpi03021]     TREPR_2532    03400 DNA repair and recombination proteins [BR:tpi03400]     TREPR_2532 Enzymes [BR:tpi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      TREPR_2532 Transcription machinery [BR:tpi03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      TREPR_2532 DNA repair and recombination proteins [BR:tpi03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       TREPR_2532 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  AEF85288 UniProt:  F5YGP5 LinkDB All DBs Position 1659624..1659818 Genome browser AA seq 64 aa AA seqDB search MIFPLEELIEYDGNMYGITSAASRRSYQLSMLKDPEIEDNEGKVVSLAARQVFTKQIDFR LESE NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgatatttcccctagaagaactgattgaatacgatggcaatatgtacgggatcacctcc gcagcctcccggcgttcctaccagctttccatgttgaaggacccggaaattgaggataat gaaggcaaggtcgtatccctggcggcccgtcaagtcttcaccaagcagatcgatttccgg ctggaatccgaataa

DBGET integrated database retrieval system